DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and TSPAN1

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_011538762.1 Gene:TSPAN1 / 10103 HGNCID:20657 Length:258 Species:Homo sapiens


Alignment Length:204 Identity:44/204 - (21%)
Similarity:78/204 - (38%) Gaps:54/204 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKIASIVLNAVLGFLAAG--AIG-WIAYNA----------DTETEEFV-IAAYIACSLILVFAL- 57
            :|...|:.|.::....|.  |:| |::.:.          .:...:|| :..::..:.::|||| 
Human     7 IKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALG 71

  Fly    58 -LGIFAAIRESVVLTATSAVFLLIL-------AILQIVSTCLFLH----------EFDVKSGRDM 104
             ||.:.|..||.....|....||::       |::.:|.|.:..|          :.|..|..|.
Human    72 FLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDF 136

  Fly   105 VEVAWQANNMDSLQQKHECCGQSSAQD-----YIHLSLLIPPSCYAD----------LQQTPDHL 154
            .:| |. ..|..|    :|||.::..|     |...:...||.|..|          .:|.....
Human   137 TQV-WN-TTMKGL----KCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQ 195

  Fly   155 YLDGCIEKV 163
            .::||..::
Human   196 KVEGCFNQL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 44/204 (22%)
tetraspanin_LEL <109..169 CDD:239401 15/70 (21%)
TSPAN1XP_011538762.1 Tetraspannin 7..214 CDD:278750 44/204 (22%)
uroplakin_I_like_LEL 110..212 CDD:239409 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.