DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and CD63

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:221 Identity:53/221 - (23%)
Similarity:95/221 - (42%) Gaps:48/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMPDA-YAIGILILGGTILVISLFGCCGAVRE 66
            ||.|.|...          :|..:::...:..||.|.: ..:.|:.:|..:.:::..|||||.:|
Human    24 CAVGLIAVG----------VGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKE 78

  Fly    67 SPRMLWTYASLLLILLLLIVAFIILNPKDVFKKYALQTVENQW--ELEQTKPGS-----MDIIQK 124
            :..::.|:|..|.:::|:.||..|..  .||:...:....|.:  ::|.....:     :|.:|.
Human    79 NYCLMITFAIFLSLIMLVEVAAAIAG--YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQA 141

  Fly   125 TYYCCGRDSAQDYLDIKFW-------NNTVPSSCCKDDS--C---VNPLNLYVRGCLIKVEEAFA 177
            .:.|||   |.:|.|   |       .|.||.|||.:.:  |   .|...::..||:.|:.    
Human   142 DFKCCG---AANYTD---WEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG---- 196

  Fly   178 DEATTLGYLEWGLLGFNAVILLLAII 203
                  |:|...:|...|..|.:|.:
Human   197 ------GWLRKNVLVVAAAALGIAFV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 47/208 (23%)
tetraspanin_LEL 94..178 CDD:239401 24/102 (24%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 53/221 (24%)
CD63_LEL 105..203 CDD:239419 26/113 (23%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.