DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and CD9

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_005253871.1 Gene:CD9 / 928 HGNCID:1709 Length:249 Species:Homo sapiens


Alignment Length:209 Identity:54/209 - (25%)
Similarity:88/209 - (42%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGTIKYSLFLFNALWAILGILVLIFG-GLGWGAMP------------DAYAIGILIL---GGTIL 53
            |..|||.||.||.::.:.||.||..| .|.:.:..            .::..|:.||   |..::
Human     7 TKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMM 71

  Fly    54 VISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFII--LNPKDVFKKYALQTVENQWELEQTK- 115
            ::...||||||:||..||..:...||::..:.:|..|  .:.||...|...:..::.:...:|| 
Human    72 LVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKD 136

  Fly   116 -PGSMDIIQKTYYCC--GRDSAQDYLDIKFWNN--TVPSSCCKDDSCVNPLNLYVRGCLIKVEEA 175
             |....:....|..|  |:|:...:|.|...:.  |.|..|...:..:.....:...||:.|.| 
Human   137 EPQRETLKAIHYAVCRLGKDTLLRFLRIVSAHRVLTAPDQCKHSNRLLTICFSHPHPCLLAVVE- 200

  Fly   176 FADEATTLGYLEWG 189
                   |.:..||
Human   201 -------LLWFGWG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 53/207 (26%)
tetraspanin_LEL 94..178 CDD:239401 19/89 (21%)
CD9XP_005253871.1 Tetraspannin 9..>147 CDD:278750 37/137 (27%)
tetraspanin_LEL 111..>149 CDD:243179 6/37 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.