DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:230 Identity:77/230 - (33%)
Similarity:111/230 - (48%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAM--PDAYA---------IGILILGGTILV 54
            |.|....:||.||:||.|.:|.|||:::||.|.:..:  .|.:|         :.::|||..||:
  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILL 65

  Fly    55 ISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILN--PKDVFKKYALQTVENQWELEQTKPG 117
            ||.||||||:|||..|..||:.||.:|::..:|.:|..  .||.:.:.....||..|....::..
  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSD 130

  Fly   118 SMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFADEATT 182
            .||.||.:..||||....||.    :....|.|||.|.:......:|.|||.:...|.:...:..
  Fly   131 YMDAIQISMKCCGRSGYTDYA----YQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNSDI 191

  Fly   183 LGYLEWGLLGFNAVILLLAIILAIHYTNRRRRYNY 217
            :.|....:.....|..:.|..||....|.|||..|
  Fly   192 IKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 66/201 (33%)
tetraspanin_LEL 94..178 CDD:239401 25/83 (30%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 70/212 (33%)
tetraspanin_LEL 104..188 CDD:239401 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.