DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and cd81a

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_571593.2 Gene:cd81a / 58031 ZFINID:ZDB-GENE-000831-5 Length:236 Species:Danio rerio


Alignment Length:245 Identity:55/245 - (22%)
Similarity:99/245 - (40%) Gaps:65/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATGTIKYSLFLFNALWAILGILVLIFGGLGW-----------------GAMPDAYAIGILIL- 48
            || |..|||.||.||.::.:.|.::|  |...|                 ...|..:.|.:.|| 
Zfish     7 GC-TKCIKYMLFFFNFIFWLAGCVIL--GVSLWLRHDTKTSSLLDLKYEGTESPTTFYISVYILI 68

  Fly    49 --GGTILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFII---LNPKD------------V 96
              |..::.:...||.||::||..:|.|:.:.|::|....||..|   :| ||            |
Zfish    69 AVGAVMMFVGFLGCYGAIQESQCLLGTFFACLVLLFACEVAAGIWGFMN-KDKISKEVIGFYDSV 132

  Fly    97 FKKYALQTVENQWELEQTKPGS--MDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVN 159
            :.|.|....:|:      .|.:  :.:..:|..|||:.:....: :..|         ..|:|..
Zfish   133 YDKGATYNTDNK------NPATAVLKVFHETLQCCGKGNLFTAI-VDRW---------LTDTCPE 181

  Fly   160 PLNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYT 209
            .|......|..:::..|.|:.:        |:|..|:::.:.:|..:.::
Zfish   182 HLRTNAVDCHTEIKNLFTDKIS--------LIGIAALVVAVIMIFEMIFS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 50/225 (22%)
tetraspanin_LEL 94..178 CDD:239401 17/97 (18%)
cd81aNP_571593.2 Tetraspannin 11..230 CDD:278750 52/240 (22%)
CD81_like_LEL 115..202 CDD:239404 19/103 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.