DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and tspan3b

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001076335.1 Gene:tspan3b / 569864 ZFINID:ZDB-GENE-070424-42 Length:253 Species:Danio rerio


Alignment Length:247 Identity:68/247 - (27%)
Similarity:114/247 - (46%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-CATGTIKYSLFLFNAL-WAILGILVLIFGGLGWGA------------MPDAY----AIGILI 47
            || |...:.|..|...|.: ||..|||..|      ||            ..|.|    |:.|:.
Zfish     1 MGQCGVISSKTVLVFLNLIFWAAAGILCYI------GAYVFITYDDYDHFFEDIYTFIPAMVIIA 59

  Fly    48 LGGTILVISLFGCCGAVRESPRMLWTYASLLLI-----LLLLIVAFIILNPKDVFKKYALQTVEN 107
            :|..:.||...|||..:|||...|.|::::||:     ::::::.:|.....:....:::|.|.|
Zfish    60 VGTLLFVIGFIGCCATIRESRCGLVTFSAVLLLVFATEVVVVVLGYIYRAKVEAVVNHSIQKVYN 124

  Fly   108 QWELEQTKPGS--MDIIQKTYYCCGRDSAQDYLD----IKFWNNTVPSSCCK------DDSCVNP 160
            :::...|...|  :|.:|:..:|||..:..|:::    |:..||:||.||||      ..:.:.|
Zfish   125 EYKGTNTDAPSRAIDYVQRQLHCCGIHNYSDWMNTHWFIESKNNSVPVSCCKPTISNRTGTLMRP 189

  Fly   161 LNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRR 212
            .:||..||.:.|.:...|   .:.|:....|.| |.|.:|.::.|.....||
Zfish   190 GDLYPEGCEVLVVKKLKD---IMLYVILAALTF-AAIQMLGLLCACVVLCRR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 59/222 (27%)
tetraspanin_LEL 94..178 CDD:239401 26/95 (27%)
tspan3bNP_001076335.1 Tetraspannin 10..237 CDD:278750 63/236 (27%)
Tweety_N <58..>94 CDD:299916 13/35 (37%)
TM4SF8_like_LEL 104..209 CDD:239416 28/107 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.