DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and tspan3a

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001020709.1 Gene:tspan3a / 565579 ZFINID:ZDB-GENE-030131-7787 Length:253 Species:Danio rerio


Alignment Length:255 Identity:69/255 - (27%)
Similarity:117/255 - (45%) Gaps:57/255 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-CATGTIKYSLFLFNAL-WAILGILVLIFGGLGWGA------------MPDAY----AIGILI 47
            || |...:.|..|...|.: ||..|||..:      ||            ..|.|    |:.|:.
Zfish     1 MGQCGITSSKTVLVFLNLIFWAAAGILCYV------GAYVFITYDDYDHFFEDVYTLIPAVVIIA 59

  Fly    48 LGGTILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFK-------KYALQTV 105
            :|..:.:|.|.|||..:|||...|.|:..:|:::.:..|..::|.  .:::       .:::|.|
Zfish    60 VGALLFIIGLIGCCATIRESRCGLATFVIILMLVFVTEVVVVVLG--YIYRAKVEDEVNHSIQKV 122

  Fly   106 ENQWELEQTKPGS--MDIIQKTYYCCGRDSAQDYLDIKFW----NNTVPSSCCKDD------SCV 158
            .|::....|...|  :|.:|:..:|||..:..|:.:.:::    ||:||.||||.:      |.:
Zfish   123 YNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESKNNSVPLSCCKPNVSNCTGSLL 187

  Fly   159 NPLNLYVRGC----LIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRR 214
            :|.:||..||    :.|::|       .:.|:.|..|.| |.|.:|.::.|.....||.|
Zfish   188 HPGDLYPEGCEELVVKKLKE-------IMMYVIWAALTF-AAIQMLGMLCACVVLCRRSR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 59/228 (26%)
tetraspanin_LEL 94..178 CDD:239401 27/106 (25%)
tspan3aNP_001020709.1 Tetraspannin 10..237 CDD:278750 63/242 (26%)
TM4SF8_like_LEL 104..210 CDD:239416 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.