DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and tspan37

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:232 Identity:57/232 - (24%)
Similarity:86/232 - (37%) Gaps:88/232 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YSLFLFNALWAILGILVLIFGGLGWGAMPDAYAIGILILGGTI--LVISLFGCCGAVRESPRMLW 72
            |.|| |:.|:.|...|:.:..|            .||.:.|:|  ||.|....||      ..|:
Zfish    39 YGLF-FSNLYIIFPALLAVVSG------------AILFITGSIGCLVSSKKPSCG------HGLF 84

  Fly    73 TYASLLLILLLLIVAFIILNP-------------------KDVFKKYALQTVENQWELEQTKPGS 118
            .|        .||:.|.::..                   ||||:.|:     |..:...||  :
Zfish    85 VY--------FLIIVFCVVGTTAALAYFYQGKLDAELAPLKDVFQNYS-----NNSQDPDTK--A 134

  Fly   119 MDIIQKTYYCCGRDSAQDYLDIKFWNNT----VPSSCCKD--DSCVN----PLNLYVRGCLIKVE 173
            :|.:|....|||..:..|:|...::|::    ||.|||..  .||..    |:.||...|.:|::
Zfish   135 VDRLQSELQCCGVMNYTDWLQTPWFNHSGKYDVPQSCCNTTFHSCNGTLDAPMLLYNEACQVKLK 199

  Fly   174 EAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTN 210
            |                       |||.::..||.|:
Zfish   200 E-----------------------LLLLVVHIIHITS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 51/216 (24%)
tetraspanin_LEL 94..178 CDD:239401 29/93 (31%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 48/188 (26%)
TM4SF8_like_LEL 102..195 CDD:239416 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.