DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and cd9b

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_005164541.1 Gene:cd9b / 406737 ZFINID:ZDB-GENE-040426-2768 Length:231 Species:Danio rerio


Alignment Length:232 Identity:59/232 - (25%)
Similarity:99/232 - (42%) Gaps:46/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATG--TIKYSLFLFNALWAILGILVLIFG-GLGWGAM----------PDAYAIGILIL---GG 50
            |.::|  .|||.:|.||.:..:.|..||..| .|.:.|.          ...:..|:.||   |.
Zfish     6 GLSSGEQCIKYIIFFFNFMLWLAGTGVLAVGLWLRFDAKTKEFFTAENGQTVFLTGVYILIVAGA 70

  Fly    51 TILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFII--LNPKDV----FKKYALQTVENQW 109
            .::|:...|||||::||..||..:...||::....||..|  |:.||.    .:::..|||:|..
Zfish    71 VMMVVGFLGCCGAIKESACMLGLFFMFLLVIFAAEVAAGIWGLSNKDKIVSDIQQFYTQTVKNYK 135

  Fly   110 E-----LEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCL 169
            |     |::|    :..|..:..|||...        ...:.|..:|.|.:...   |:...||.
Zfish   136 ESPDGPLKET----LTAIHFSLQCCGPTG--------LVTDGVSVTCPKQEGLA---NVITTGCS 185

  Fly   170 IKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAI 206
            ..:::.|......:|.:..|:    .||::..:|.::
Zfish   186 SVIQDMFNSRLHVIGGVGIGI----GVIMVFGMIFSM 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 54/213 (25%)
tetraspanin_LEL 94..178 CDD:239401 20/92 (22%)
cd9bXP_005164541.1 Tetraspannin 13..224 CDD:278750 57/225 (25%)
CD9_LEL 113..196 CDD:239405 21/97 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.