DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp66E

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:108/278 - (38%) Gaps:83/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATGTIKYSLFLFNALWAILGILVLIFG-GLGWGAM----------------------PDA---Y 41
            |.....||.|.:||.::.:||  .:||| || |.|:                      |.|   .
  Fly     5 CGVWCAKYLLCIFNFIFFVLG--TIIFGVGL-WLAVDKHSLIALLKLVESERIEQFTQPQAIEQL 66

  Fly    42 AIGILILGGTILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVF--------K 98
            |..:|::|..:..:|..|..||:|||..:|.||.:   .|:||::|.|:......|        .
  Fly    67 AYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGT---FLILLLIAEIVAGGLGAFFKDKVRAES 128

  Fly    99 KYALQTVENQWEL-EQTKPGSM--DIIQKTYYCCGRDSAQDYLDIKFW-----NNTVPSSCC--- 152
            |..|||....:.| |.....|:  :.:...:.|||.:...|:.....|     |.|:|.:||   
  Fly   129 KNFLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGKGNRTIPDACCILK 193

  Fly   153 -------KDDSC-VNPL---NLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLA----- 201
                   :|:.| .||.   :.|.:||.    |.|.         ||.:.....||:.:|     
  Fly   194 DVAKLVPRDEDCTTNPSDSNSFYKKGCY----EVFT---------EWLIRQRELVIVAIAVGIVH 245

  Fly   202 ---IILAIHYTNRRRRYN 216
               ||||........:||
  Fly   246 LVLIILAFALCKAFAKYN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 63/244 (26%)
tetraspanin_LEL 94..178 CDD:239401 27/113 (24%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 70/267 (26%)
uroplakin_I_like_LEL 116..231 CDD:239409 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.