DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and tspan2a

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001018160.1 Gene:tspan2a / 378854 ZFINID:ZDB-GENE-050522-511 Length:211 Species:Danio rerio


Alignment Length:232 Identity:60/232 - (25%)
Similarity:105/232 - (45%) Gaps:50/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATGTIKYSLFLFNALWAILGILVLIFG-----------GLGWGAMPDAYAIGILIL---GGTI 52
            ||.. .:||.||:||.::.:.|.|||..|           .|.....|:.:.|.:.||   ||.:
Zfish     6 GCMK-CVKYLLFVFNFIFWLSGSLVLAVGLWLRFDPDTTSLLSENDAPENFFIAVYILIGAGGIM 69

  Fly    53 LVISLFGCCGAVRESPRMLWTYASLLLILLLLIVA---FIILNPKDVFKKYALQTVENQWELEQT 114
            :::..|||.||||||..:|.::.:.||::....||   |..||...:.|:     |:|.:| ..|
Zfish    70 MIVGFFGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGFLNKDQIIKE-----VQNYYE-SAT 128

  Fly   115 KPGSMDIIQKTYY----CCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEA 175
            |..:..:|...::    |||.:|:             |...|.:.:         :.|:..:|:.
Zfish   129 KMENGTVITSAFHSVLDCCGTESS-------------PIETCTEGN---------KDCVQAIEDF 171

  Fly   176 FADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRR 212
            |.::...:||:..|:.|...:.::.:::|.....|.|
Zfish   172 FNEKLFIIGYVGIGIAGVMVIGMIFSMVLCCAIRNSR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 55/209 (26%)
tetraspanin_LEL 94..178 CDD:239401 16/87 (18%)
tspan2aNP_001018160.1 Tetraspannin 10..204 CDD:278750 56/221 (25%)
tetraspanin_LEL 110..176 CDD:243179 18/93 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.