DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and TM4SF

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:270 Identity:58/270 - (21%)
Similarity:88/270 - (32%) Gaps:100/270 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYSLFLFNALWAILGILVLIFG-GLGWGAMPDAY-----------AIGILILGGTILVISLFGCC 61
            ||.::.:..|.|:.|...:..| .|.||  ...|           |..:|.||....::...||.
  Fly    11 KYLVYSYVVLLALTGAAQIFLGTSLLWG--HSVYYGIVQNKLWAPAAILLCLGPVTFILCWMGCQ 73

  Fly    62 GAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKYALQTVENQWEL--EQTKPGSMDI--- 121
            ...:....:|..:|:||  :..:.|.|||..                |.|  .:..|.|::|   
  Fly    74 ATNQRKRCLLGMFAALL--VACICVQFIICG----------------WSLAMRENLPTSVEIFID 120

  Fly   122 -----------------------IQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCK------DDSC 157
                                   :|....|||.|...||..:     ::|.|||.      :.:|
  Fly   121 DSFVEFLDKFSRTKVDNLHLWNRMQSQLQCCGVDGPLDYRRL-----SLPWSCCSRPEHAYESAC 180

  Fly   158 VNPLNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILL----LAIILAIHYT--------- 209
            ...   |.||||..|.|...:...        :..|.|.|:.    |.|..|:|.|         
  Fly   181 DTH---YKRGCLAVVSEQIRNRLL--------ITAFGAAIIAIFQSLGIFCAVHLTILFGKNDNT 234

  Fly   210 -----NRRRR 214
                 ||:::
  Fly   235 HPMNMNRKKK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 49/232 (21%)
tetraspanin_LEL 94..178 CDD:239401 24/117 (21%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 54/248 (22%)
uroplakin_I_like_LEL 111..197 CDD:239409 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.