DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Er

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:222 Identity:63/222 - (28%)
Similarity:106/222 - (47%) Gaps:16/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFG--GLGWGAMPDAYAIGILI-LGGTILVISLFGCCG 62
            ||.:...|:|..||||.|.|:|||..::..  .:...|..|...:|:.| :|..:.::|.|||.|
  Fly     1 MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILGLYIAVGSIVFLLSFFGCFG 65

  Fly    63 AVRESPRMLWTYASLLLILLL--LIVAFIILNPKDVFKKYALQTVENQWELEQTKPGSMDIIQKT 125
            |::||..:.|.||:.:|::|:  :::.|:.   :..|::.::..::..:..:.....:|...|..
  Fly    66 AIKESICVTWAYATSMLVMLIVSIVMLFVF---RMHFEEDSITKLKQAFAKQTNTFDAMAEYQTQ 127

  Fly   126 YYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFADEATTLGYLEWGL 190
            |.|||....:||.|...   ||||||.  |....|   |..|||.|:|..:.:.......:.|.|
  Fly   128 YQCCGIYKLKDYGDAYI---TVPSSCY--DQNDTP---YRDGCLAKMETQYEELLKGPKIVGWML 184

  Fly   191 LGFNAVILLLAIILAIHYTNRRRRYNY 217
            :.........:.|:.:...|..||..|
  Fly   185 MVIEIGAFTFSTIMGVSLRNELRRSAY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 56/193 (29%)
tetraspanin_LEL 94..178 CDD:239401 24/83 (29%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 56/197 (28%)
tetraspanin_LEL 93..174 CDD:239401 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467714
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26943
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.