DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:216 Identity:51/216 - (23%)
Similarity:84/216 - (38%) Gaps:22/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYSLFLFNALWAILGILVLIFGGLGWGAMPDAY-AIGILILGGTILVISLFGCCGAVRESPRMLW 72
            ||.|.:...|.....:.....|...||:....| :.|..:.||.:..::..|...|::.|    :
  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSALCGGAVFGVAFLGMYVALKVS----Y 71

  Fly    73 TYASLLLILLLLIVA------FIILNPKDVFKKYALQTVENQWELEQTKPGSMDIIQKTYYCCGR 131
            .|:...||...|::|      |.....::.......:.:.:.:|.:......|..:...:.|||.
  Fly    72 KYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGI 136

  Fly   132 DSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAV 196
            :..||||..:  :..:|||||....|..|.::|..||..|.      .||.....|.......|:
  Fly   137 EGPQDYLQEE--HGALPSSCCYAFDCSKPAHVYEEGCSTKA------VATLRMQAELNYYSCMAI 193

  Fly   197 ILL--LAIILAIHYTNRRRRY 215
            |.|  |.:..|.| ..:.|:|
  Fly   194 IALEFLGLFTAYH-LGKARKY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 43/193 (22%)
tetraspanin_LEL 94..178 CDD:239401 20/83 (24%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 49/212 (23%)
tetraspanin_LEL 97..183 CDD:239401 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.