DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:240 Identity:69/240 - (28%)
Similarity:117/240 - (48%) Gaps:39/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGLGW-GAMPDAYAIG-------ILILGGTILVISL 57
            ||....|:|:.|.|.|.::::||:.::.||.... .|..:|.:||       |:.||..||:|::
  Fly     1 MGLGATTVKHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIGKNVAGGLIIALGVVILIIAI 65

  Fly    58 FGCCGAVRESPRMLWTYASLLLILLLLIVAFIILN---PKDVFKKYALQTVENQWELEQTKPGSM 119
            |||..|:.|:|..|..|...:::|:|..:.|:.::   .||.......:..:..||.|:.:.|::
  Fly    66 FGCLAAIHEAPVRLLIYVGAVVLLILAQLIFLGMSSHGTKDGISGSINEGFDRLWESERNQTGAL 130

  Fly   120 DIIQKTYYCCGRDSAQDYLDIKFW--NNTVPSSCCKDDSCVN-PLNLYVRGCLIKVEEAFADEAT 181
            ...:....|||.:|::||     |  ::.:|||||.:..|:: |..::..||          :|.
  Fly   131 SYYESWLQCCGVNSSEDY-----WIIHHGIPSSCCPESKCMDTPSRVFKTGC----------KAA 180

  Fly   182 TLGYLEWGLLGFNAVILLLAI----------ILAIHYTNRRRRYN 216
            .:.||:..||.|..|..||.|          :|.....|:.||.|
  Fly   181 FVKYLDDKLLVFKIVCWLLVIGEAVGAVFGWLLYSSVKNQSRRNN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 58/202 (29%)
tetraspanin_LEL 94..178 CDD:239401 22/86 (26%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 63/224 (28%)
DUF373 <17..>101 CDD:299895 25/83 (30%)
tetraspanin_LEL 104..189 CDD:239401 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.