DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:234 Identity:63/234 - (26%)
Similarity:111/234 - (47%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGG------------LGWGAMPDAYAIGILILGGTIL 53
            |.|.|..::|.|.:.:.:.|:.|.|::.:|.            ||.....|..|:..::||..|:
  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIV 65

  Fly    54 VISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILN---PKDVFKKYALQTVENQWELEQTK 115
            |.|:||.....::|..:|..||.||:.||::.:..:.::   .:|.......|.:::.|:|:...
  Fly    66 VASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQHEG 130

  Fly   116 PGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFADEA 180
            ..:::..::..:||||:||:|||.::   ...|.|||.:..|...|||::.||.:|.:|....:.
  Fly   131 NSTLNTYEEWLHCCGRNSAEDYLHLE---KMPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGAKT 192

  Fly   181 TTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRR---YN 216
            .....|.|.|:.|.....:....|.....|.|.|   ||
  Fly   193 ANFHSLSWFLVIFEFAGSVTTCYLVDSIRNHRDRIRFYN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 54/203 (27%)
tetraspanin_LEL 94..178 CDD:239401 25/83 (30%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 55/214 (26%)
tetraspanin_LEL 109..192 CDD:239401 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.