DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:234 Identity:67/234 - (28%)
Similarity:106/234 - (45%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMP-----DAYAIGILILGGTILVISLFGC 60
            |.|:|..:|.....::.:.|:.|::|:   |||...:.     :..|..|:.:|..:::.:|||.
  Fly     1 MACSTNVLKGFALFWDIILALFGLVVI---GLGVHIIYKFEHFNTAAFVIIAVGVVVVLTALFGA 62

  Fly    61 CGAVRESPRMLWTYASLLLILLL---LIVAFIILNPKDVFKKYAL----QTVENQWELEQT--KP 116
            .||.|||......:..:|::|::   |.|.|:.     ||:...|    :|.:..|..:..  ||
  Fly    63 LGAARESSATSKVFVVILIVLVILEVLAVGFLW-----VFQTSLLINVDKTFDKLWNDQPVPIKP 122

  Fly   117 GSMDII---QKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFAD 178
            |:...|   ::...|||.....||:       ..|:||...:|  :.|||  .||..|..:..||
  Fly   123 GNQSQIASLERWLDCCGNVGPSDYI-------LPPNSCYNGES--DKLNL--EGCRQKFLDFIAD 176

  Fly   179 EATTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRRYNY 217
            ..||...:...|||...:..|||.:||....||.||..|
  Fly   177 RWTTFNLVSLVLLGVELICALLAYVLANSIVNRWRRSKY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 54/205 (26%)
tetraspanin_LEL 94..178 CDD:239401 24/92 (26%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 56/203 (28%)
tetraspanin_LEL 95..176 CDD:239401 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443029
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.