DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Ee

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster


Alignment Length:233 Identity:84/233 - (36%)
Similarity:121/233 - (51%) Gaps:21/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGL-----------GWGAMPDAYAIGILI--LGGTI 52
            |.|.|..:||.||:||.:.:::|||.:::|.|           |....|....:.|::  ||..:
  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIV 65

  Fly    53 LVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIIL--NPKDVFKKYALQTVENQWELEQT- 114
            :.||..|||||:|||..|..:||:.|||||:|.:.|::|  ..::.|:......:||.|..|.| 
  Fly    66 VFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWNSEHTY 130

  Fly   115 KPGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFADE 179
            |.|..|.|||:.:|||..||.||:.   ..:.||.||| ..||:.|.| |..||..|..|.....
  Fly   131 KGGVFDTIQKSLHCCGSSSALDYIG---KGDLVPPSCC-SGSCLIPTN-YYPGCRGKFVELMTTG 190

  Fly   180 ATTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRRYNY 217
            :....|:..||:|...:..:.|..||.:..|.:||..|
  Fly   191 SDNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRNAY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 74/204 (36%)
tetraspanin_LEL 94..178 CDD:239401 33/84 (39%)
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 77/215 (36%)
tetraspanin_LEL 106..187 CDD:239401 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467696
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.