DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp42Ed

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster


Alignment Length:240 Identity:79/240 - (32%)
Similarity:123/240 - (51%) Gaps:36/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFG-----------GLGWGAMPDAYAIGILILGGTILV 54
            |.|....:||.||:||.|:.|.|||::.||           |:|.....::.||.||:||..:.:
  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSVAIIILVLGCVVFL 65

  Fly    55 ISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKD-VFKKYALQ-TVENQWELEQTKPG 117
            ::..|||||:||:...|.:|:.::|:||:..:|.||....| |..:.:|: .|:..|:..:|...
  Fly    66 VAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDAL 130

  Fly   118 SMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLN-------LYVRGCLIKVEEA 175
            .||.:|:::.|||.:...||      ..|.|:|||  ||   |.|       :..|...:|..::
  Fly   131 LMDTLQRSFKCCGLNGFADY------GITYPASCC--DS---PSNGTCALTQVMTRSSCLKAVDS 184

  Fly   176 FADEATTLGYLEWGLLGFNAVIL---LLAIILAIHYTNRRRRYNY 217
            |.|  |.:..:::..||..||.|   :.|..||....|.:||.||
  Fly   185 FWD--TNVSIIKYAGLGVTAVELVAFIFACCLANQTRNSQRRQNY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 66/208 (32%)
tetraspanin_LEL 94..178 CDD:239401 26/92 (28%)
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 72/221 (33%)
tetraspanin_LEL 104..189 CDD:239401 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.