DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp33B

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:256 Identity:52/256 - (20%)
Similarity:92/256 - (35%) Gaps:92/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AILGILVLI----FGGLGWGAMPD-------AYAIGILILGGTILVISLFGCCGAV-------RE 66
            |::|:|:|:    :..:..|.:.|       .|..||.:.|..::|  .|.|..|:       |.
  Fly    20 AVIGLLILVVTAYYHTVLTGYLSDIECRLVYGYLFGIYVFGAQVVV--TFLCSIAMWRRIWRRRC 82

  Fly    67 SPRM-----LWTYASLLLILLLLIVAFIILNPKDVFKKYALQTVEN---------QWELEQTKPG 117
            :|.:     :|.:.|.::|.......:.:....||.:..|..::..         :|:|      
  Fly    83 TPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSLTRGIDMYYSCPEWKL------ 141

  Fly   118 SMDIIQKTYYCCGRDSAQDYLDIKFW-----NN-----TVPSSCCKD--DSCVNPL--------- 161
            ..|.:|....|||....:|:::.: |     ||     ..|.:|||.  |||.|..         
  Fly   142 LWDGLQWHKECCGVHGYKDWMNAE-WMPRRENNCTSMVLAPFACCKRSCDSCFNNFLPSEGQSIG 205

  Fly   162 -------------NLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAI-ILAIHY 208
                         ::...|||    .||....       |     |...:|:|: :||:.:
  Fly   206 GNSRQPFPALTVDSINANGCL----PAFVSAV-------W-----NCFYILMALWVLALKF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 48/241 (20%)
tetraspanin_LEL 94..178 CDD:239401 27/126 (21%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 52/256 (20%)
CD151_like_LEL 112..237 CDD:239408 29/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443032
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.