DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp26A

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster


Alignment Length:212 Identity:54/212 - (25%)
Similarity:87/212 - (41%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IKYSLFLFNALWAILGILVLIFGGLGWG--------------AMPDAYAIGILILGGTILVISLF 58
            :||.||..|.:..:..:|||..|...|.              |:..|:.  ::||||...::...
  Fly    19 LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFV--LIILGGVTFLLGFM 81

  Fly    59 GCCGAVRESPRMLWTYASLLLILLLLIVAF----IILNPKDVFKKYA---LQTVENQWELEQTKP 116
            |..||:||:..:|..||..|.:||:..:.|    .:|..|...|..|   |:.....:..:..:.
  Fly    82 GSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQ 146

  Fly   117 GSMDIIQKTY-YCCGRDSAQDYLDIKFWNNT-----------VPSSCC--------KDDSCVNPL 161
            ..:|.||:.: .|||.|..:|:....::|.:           ||.|||        |:..|...:
  Fly   147 NLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVIKNKQCGYDV 211

  Fly   162 ---------NLYVRGCL 169
                     |::.||||
  Fly   212 RKEGYPVDRNIHERGCL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 54/212 (25%)
tetraspanin_LEL 94..178 CDD:239401 25/108 (23%)
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 54/212 (25%)
DUF2207 <65..157 CDD:303056 25/93 (27%)
TM4SF9_like_LEL 118..239 CDD:239412 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.