DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and cd63

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:225 Identity:56/225 - (24%)
Similarity:104/225 - (46%) Gaps:30/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IKYSLFLFNALWAILGILVLIFGGL------------GWGAMPDAYAIGILILGGTILVISLFGC 60
            :||.||.||.::.:.|:.:::.|.|            |....|    :.::::|..|..||.|||
Zfish    10 VKYLLFFFNFIFWLCGLALIVLGILVHVSLHNTAILQGASGSP----MVLIVVGVIIFFISFFGC 70

  Fly    61 CGAVRESPRMLWTYASLLLILLLL-----IVAFIILNPKDVFKKYALQTVENQWELEQTKPGSMD 120
            |||.:|:..|:.|:|.:|.::::.     |..:|.....:.....:..|:...:...:....::|
Zfish    71 CGAWKENQCMVVTFAIILSLIVITEIGAGIAGYIFRGKVNELLDQSFNTMIAGYNKTEEYRTTLD 135

  Fly   121 IIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKD--DSC-----VNPLNLYVRGCLIKVEEAFAD 178
            .|||...|||.:|:.|:::....:.:||.||||:  .:|     ..|..:|:.||...:|....:
Zfish   136 SIQKQLKCCGGNSSSDWVNFSADHISVPDSCCKNVTKNCGIGAMTKPTVIYLEGCQPILETRIKE 200

  Fly   179 EA--TTLGYLEWGLLGFNAVILLLAIILAI 206
            ..  ..:|.|..|.:....::|...:..||
Zfish   201 NILWIAVGALVIGFVQITGIVLACILSRAI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 53/213 (25%)
tetraspanin_LEL 94..178 CDD:239401 22/90 (24%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 54/223 (24%)
CD63_LEL 103..202 CDD:239419 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.