DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tsp5D

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:249 Identity:62/249 - (24%)
Similarity:103/249 - (41%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLFNALWAILGILVLIFGGLGW------GAMPDAYAIGILILGGTILVISLFGCCGAVRESPRML 71
            ||...||     |.|.:.|...      |...|...:||   |||..|:|.||||||..:|..:|
  Fly    27 FLGAGLW-----LRLSYAGYATLLPQHAGLSADTIFMGI---GGTGFVVSFFGCCGAWVQSRCLL 83

  Fly    72 WTYASLLLILLLLIVAFIILNPKDVFKKYALQTVENQWEL------EQTKPGSM---------DI 121
            ..|  .:||::|.:..|::.:...:|:....:|:.|:...      ..:..||:         |.
  Fly    84 VLY--FMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDS 146

  Fly   122 IQKTYYCCGRDSAQDYLDIKFW--NNTVPSSCCK---DDSCV------------------NPLNL 163
            :|:::.|||..|.:|:.||:.|  ...||.|||:   |...|                  ||...
  Fly   147 VQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLW 211

  Fly   164 YVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRRYNY 217
            :.:||...::..|..:...:|.:..|:.......|:.:::|.....::|....|
  Fly   212 WDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 58/226 (26%)
tetraspanin_LEL 94..178 CDD:239401 27/121 (22%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 60/238 (25%)
NET-5_like_LEL 105..228 CDD:239418 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.