DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Tspan3

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001005547.1 Gene:Tspan3 / 300733 RGDID:1359444 Length:253 Species:Rattus norvegicus


Alignment Length:260 Identity:71/260 - (27%)
Similarity:113/260 - (43%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-CATGTIKYSLFLFNAL-WAILGILVLIFGGLGWGA------------MPDAY----AIGILI 47
            || |...:.|..|...|.: |...|||..:      ||            ..|.|    |:.|:.
  Rat     1 MGQCGITSSKTVLVFLNLIFWGAAGILCYV------GAYVFITYDDYDHFFEDVYTLFPAVVIMA 59

  Fly    48 LGGTILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKYALQT-VENQ--- 108
            :|..:.:|.|.|||..:|||...|.|:..:||::.:..|..::|.       |..:. |||:   
  Rat    60 VGALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLG-------YVYRAKVENEVDR 117

  Fly   109 --WELEQTKPG--------SMDIIQKTYYCCGRDSAQDYLDIKFW----NNTVPSSCCKDD--SC 157
              .::.:|..|        ::|.:|:..:|||..:..|:.:..::    |.:||.|||::.  ||
  Rat   118 SIQKVYKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETARSC 182

  Fly   158 ----VNPLNLYVRGC----LIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRRRR 214
                .||.:||..||    :.|::|       .|.::.|..|.| |.|.||.::.|.....||.|
  Rat   183 NGSLANPSDLYAEGCEALVVKKLQE-------ILMHVIWAALAF-AAIQLLGMLCACIVLCRRSR 239

  Fly   215  214
              Rat   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 60/233 (26%)
tetraspanin_LEL 94..178 CDD:239401 28/111 (25%)
Tspan3NP_001005547.1 Tetraspannin 10..237 CDD:278750 65/247 (26%)
TM4SF8_like_LEL 104..210 CDD:239416 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.