DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Cd63

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:197 Identity:49/197 - (24%)
Similarity:83/197 - (42%) Gaps:58/197 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATGTIKYSLFLFNALWAILGILVLIF-----------GGLGWGAMPDAYAIGILILGGTILVIS 56
            ||.|.|            .:|:.|.:.           |.|    :|    :.|:.:|..:.:::
  Rat    48 CAVGLI------------AIGVAVQVVLKQAITHETTAGSL----LP----VVIIAVGAFLFLVA 92

  Fly    57 LFGCCGAVRESPRMLWTYASLLLILLLLIVAFIIL------NPKDVFKKYALQTVENQWELEQTK 115
            ..|||||.:|:..::.|:|..|.:::|:.||..|.      ..|..|.|...:.::|.  |...|
  Rat    93 FVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNY--LTDNK 155

  Fly   116 PGS-MDIIQKTYYCCGRDSAQDYLDIKFW-------NNTVPSSCCKDDS--CVNPL---NLYVRG 167
            ..: :|.:||...|||   |.:|.|   |       .:.||.|||.:.:  |.|..   .::.:|
  Rat   156 TATILDKLQKENKCCG---ASNYTD---WERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQG 214

  Fly   168 CL 169
            |:
  Rat   215 CV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 46/193 (24%)
tetraspanin_LEL 94..178 CDD:239401 25/89 (28%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 49/197 (25%)
ATP-synt_A <72..131 CDD:294288 18/66 (27%)
CD63_LEL 129..227 CDD:239419 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.