DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and Cd81

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_037219.2 Gene:Cd81 / 25621 RGDID:2315 Length:236 Species:Rattus norvegicus


Alignment Length:240 Identity:63/240 - (26%)
Similarity:104/240 - (43%) Gaps:55/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATGTIKYSLFLFN-ALW----AILGILV----------LIFGGLGWGAMPDAYAIGILIL--- 48
            || |..|||.||:|| ..|    .|||:.:          |::..||....|..:.:||.||   
  Rat     5 GC-TKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGDKPAPSTFYVGIYILIAV 68

  Fly    49 GGTILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILN-------PKDV--FKKYALQT 104
            |..::.:...||.||::||..:|.|:.:.|:||....||..|..       .|||  |...|||.
  Rat    69 GAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQ 133

  Fly   105 VENQWELEQTKPGSMDIIQKTYY----CCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYV 165
            .....:....|     .:.||::    |||.::.          .|:.::..::..|.:..|.:.
  Rat   134 AVMDDDANNAK-----AVVKTFHETLNCCGSNTL----------TTLTTTVLRNSLCPSSSNSFT 183

  Fly   166 R----GCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAI 206
            :    .|..|::|.|:.:...:|.....:    |||::..:||::
  Rat   184 QLLKEDCHQKIDELFSGKLYLIGIAAIVV----AVIMIFEMILSM 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 55/223 (25%)
tetraspanin_LEL 94..178 CDD:239401 20/93 (22%)
Cd81NP_037219.2 Tetraspannin 10..226 CDD:395265 60/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.