DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and tsp-4

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_502396.2 Gene:tsp-4 / 192060 WormBaseID:WBGene00006630 Length:241 Species:Caenorhabditis elegans


Alignment Length:239 Identity:56/239 - (23%)
Similarity:94/239 - (39%) Gaps:68/239 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYSLFLFNALWAILGILVLIFGGLGWGAMPDAYAIGILI-------------------------- 47
            |.:.|||..|  .||::|:       |.|...|:|.:::                          
 Worm     8 KLANFLFFIL--NLGLIVV-------GVMITWYSIWMILHQFEVTVARTSLVSFLSVDNIEWFYV 63

  Fly    48 -------LGGTILVISLFGCCGAVRESPRMLWTYASLL-LILLLLIVAFII-LNPKDVFKK---- 99
                   :||.::|:.|.||......|...|..:..|: |:.::.|||.:: |..||..::    
 Worm    64 YRTISIMIGGCMVVLGLCGCFAVCFGSKTALSVHLVLVFLVFVVKIVAIVMFLANKDHLRREFVG 128

  Fly   100 -YALQTVENQWELEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNL 163
             |..:.|.|.....:|| .::|.:..:..|||.:..:|:|..    ...|:||    .| ...|.
 Worm   129 VYRDELVANYHNNSRTK-NTLDWVHTSLKCCGANGCEDFLPA----GNFPTSC----EC-GTKNA 183

  Fly   164 YVR--GCLIKVEEAFADEATTLGYL-------EWGLLGFNAVIL 198
            .||  ||.:.....|.|....:.:|       |.||:.|.|:::
 Worm   184 MVRMEGCALITWAVFEDGTLQVAFLGLICMLIELGLMIFAAIVI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 55/235 (23%)
tetraspanin_LEL 94..178 CDD:239401 23/90 (26%)
tsp-4NP_502396.2 Tetraspannin 11..223 CDD:278750 53/230 (23%)
tetraspanin_LEL 116..191 CDD:239401 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.