DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and tsp-6

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001294830.1 Gene:tsp-6 / 13219712 WormBaseID:WBGene00006632 Length:237 Species:Caenorhabditis elegans


Alignment Length:242 Identity:56/242 - (23%)
Similarity:100/242 - (41%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMPDAYAIG---------------------- 44
            ||....:||..:|.|.|:.:||.:::   ||....:.|..::.                      
 Worm     4 GCGNKCVKYFFWLINFLFFVLGAIIV---GLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQL 65

  Fly    45 ------ILILGGTILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIIL------NPKDVF 97
                  .:::||.:||:..|||||:..||...:..|..|:|||.::.|..|:|      |.:..|
 Worm    66 NSFLYVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNKTNLQQGF 130

  Fly    98 KKYALQTVENQWELEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLN 162
            :......:.:::..:|.....:|.||.:..|||.....||:..    ...|:||    .|.   .
 Worm   131 QTIWRDELVSKYNTQQQIHQVLDQIQSSLQCCGASGCSDYIPY----GAFPTSC----QCA---T 184

  Fly   163 LYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYT 209
            :...||...:..:|   .::|.|     :.|..:|:|...:||:.::
 Worm   185 IQQAGCATVIWNSF---ESSLIY-----VAFVGIIILFVELLAMIFS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 50/222 (23%)
tetraspanin_LEL 94..178 CDD:239401 17/83 (20%)
tsp-6NP_001294830.1 Tetraspannin 9..227 CDD:278750 54/237 (23%)
tetraspanin_LEL 120..202 CDD:239401 18/95 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.