DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42El and TSPAN2

DIOPT Version :9

Sequence 1:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_005716.2 Gene:TSPAN2 / 10100 HGNCID:20659 Length:221 Species:Homo sapiens


Alignment Length:234 Identity:57/234 - (24%)
Similarity:105/234 - (44%) Gaps:55/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IKYSLFLFNALWAILGILVLIFGGLGW----GAM---------PDAYAIGILIL---GGTILVIS 56
            |||.|..||.|:.:.|..|:.||  .|    ||:         |:.:.:|:.:|   |..::.:.
Human    11 IKYLLLGFNLLFWLAGSAVIAFG--LWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMMAVG 73

  Fly    57 LFGCCGAVRESPRMLWTYASLLLILLLL-----IVAFIILNPKDVFKKYALQTVENQWE------ 110
            .||||||:|||..:|.::.:.||::...     :.|||       .|..|::.|:..:|      
Human    74 FFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFI-------GKGVAIRHVQTMYEEAYNDY 131

  Fly   111 LEQTKPGSMDII--QKTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVE 173
            |:....|:..:|  ..|:.|||::|::.          |..:|.|:       .|..:.|:.::|
Human   132 LKDRGKGNGTLITFHSTFQCCGKESSEQ----------VQPTCPKE-------LLGHKNCIDEIE 179

  Fly   174 EAFADEATTLGYLEWGLLGFNAVILLLAIILAIHYTNRR 212
            ...:.:...:|.:..|:.|.....::.:::|.....|.|
Human   180 TIISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 54/216 (25%)
tetraspanin_LEL 94..178 CDD:239401 18/91 (20%)
TSPAN2NP_005716.2 Tetraspannin 11..210 CDD:395265 54/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.