DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and CD81

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_004347.1 Gene:CD81 / 975 HGNCID:1701 Length:236 Species:Homo sapiens


Alignment Length:138 Identity:32/138 - (23%)
Similarity:43/138 - (31%) Gaps:54/138 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LCGGAVFGVAF---------------LGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMR 99
            |.||.:.|||.               ||...|....| ..||.||..|.|:..:| :|..:.|::
Human    23 LAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFY-VGIYILIAVGAVMMFVG-FLGCYGAIQ 85

  Fly   100 EQ--LMGRFEERMRDLF-------------------ERKTHSDDKMQPV---------------- 127
            |.  |:|.|...:..||                   :.|...|..:|..                
Human    86 ESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTF 150

  Fly   128 HSLFGCCG 135
            |....|||
Human   151 HETLDCCG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 32/138 (23%)
tetraspanin_LEL 97..183 CDD:239401 14/76 (18%)
CD81NP_004347.1 Tetraspannin 10..226 CDD:395265 32/138 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.