DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and tspan37

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:253 Identity:57/253 - (22%)
Similarity:101/253 - (39%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVTCILIVTCNVFFFSCGVTTWGSA-----VSVYGSYGS----------ALCGGAV-FGVAFLG 62
            |.:||:|       |...|:|..|.:     ..|||.:.|          |:..||: |....:|
Zfish    12 LKITCLL-------FLLTGITGLGGSFLLHKYRVYGLFFSNLYIIFPALLAVVSGAILFITGSIG 69

  Fly    63 MYVALK---VSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEER---MRDLFERKTHSD 121
            ..|:.|   ..:...:|:||   :|...:|    |..|:.....|:.:..   ::|:|:  .:|:
Zfish    70 CLVSSKKPSCGHGLFVYFLI---IVFCVVG----TTAALAYFYQGKLDAELAPLKDVFQ--NYSN 125

  Fly   122 DKMQP-------VHSLFGCCGIEGPQDYLQE---EHGA---LPSSCCYA--FDCS----KPAHVY 167
            :...|       :.|...|||:....|:||.   .|..   :|.|||..  ..|:    .|..:|
Zfish   126 NSQDPDTKAVDRLQSELQCCGVMNYTDWLQTPWFNHSGKYDVPQSCCNTTFHSCNGTLDAPMLLY 190

  Fly   168 EEGCSTKAVATLRMQAELNYYSCMAIIALEFLGLFTAYHLGKARKY---AKTKIKDEE 222
            .|.|..|....|.:...:.:.:.:.::.|..|...|   :|:..:|   .:.:|.|::
Zfish   191 NEACQVKLKELLLLVVHIIHITSLVVLVLLVLSWIT---VGQLMRYPVPQEYRILDQD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 54/237 (23%)
tetraspanin_LEL 97..183 CDD:239401 25/107 (23%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 46/195 (24%)
TM4SF8_like_LEL 102..195 CDD:239416 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.