DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and tspan18b

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_005159229.1 Gene:tspan18b / 436712 ZFINID:ZDB-GENE-040718-137 Length:258 Species:Danio rerio


Alignment Length:193 Identity:42/193 - (21%)
Similarity:75/193 - (38%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTW-------------GSAVSVYGSYGSALCGGAVFGVAFLG 62
            ||.:.|...||.....|....||  |             .:.:...|.|.....||.:|.:.|||
Zfish    22 KYLMFVFNFLIFLGGSFLLGVGV--WVVVDPTGFREIVAANPLLFTGVYIILAMGGMLFLLGFLG 84

  Fly    63 MYVALK-----VSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSD- 121
            ...|::     :.:.:.:..:|....:.||:.:::|.....||.    |.:.::..::...::| 
Zfish    85 CCGAIRENKCLLLFFFMLILIIFLAELAAAILAFIFREHLTREY----FTKELKKHYQGYNNTDV 145

  Fly   122 --DKMQPVHSLFGCCGIEGPQDYLQEE--------HGALPSSCCYAFDCSKPAHVYEEGCSTK 174
              .....:.:.|.|||:..|:|:  ||        ...:|.:|     |.:..||.|.|.|.:
Zfish   146 FTSTWNAIMNTFDCCGVNSPEDF--EESIFRIINPSEMVPEAC-----CRRNNHVGESGFSNR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 42/193 (22%)
tetraspanin_LEL 97..183 CDD:239401 20/89 (22%)
tspan18bXP_005159229.1 Tetraspannin 20..257 CDD:278750 42/193 (22%)
uroplakin_I_like_LEL 118..229 CDD:239409 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.