DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp96F

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:280 Identity:56/280 - (20%)
Similarity:92/280 - (32%) Gaps:76/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TCI--LIVTCNVFFFSCGVT-----TWG--------SAVSVYGSYGSALCGGAVFGV-----AFL 61
            :|:  |:|..|:.|:..|:|     .|.        |....|..|..||......|:     ||.
  Fly     8 SCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFF 72

  Fly    62 GMYVALKVSYKYSIYYLICSGLVI----AALGSYLF---------TFTAMREQLMGRFEERMRDL 113
            |.....:.|....:.: .|..|::    .|.|::.|         ...|::..:.   ||..:..
  Fly    73 GCCGVCRESQCLLVSF-FCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQ---EEYGQST 133

  Fly   114 FERKTHSDDKMQPVHSLFGCCGIEGPQDYLQEEHG-------------------ALPSSCC---- 155
            ...:|.:.|.:|   ....|||.:||.|:......                   .:|.|||    
  Fly   134 MSSRTVTFDTLQ---KNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNL 195

  Fly   156 ----------YAFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCMAIIALEFLGLFTAYHLGKA 210
                      ..|.......:|::||..|.:..:.......:....|:|.||.|.|..|..|..|
  Fly   196 KDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCA 260

  Fly   211 ---RKYAKTKIKDEETPIND 227
               :.|.. ::::....|.|
  Fly   261 VRNQHYKAXELQNSHREITD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 53/262 (20%)
tetraspanin_LEL 97..183 CDD:239401 21/118 (18%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 52/258 (20%)
CD151_like_LEL 107..233 CDD:239408 22/131 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.