DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp74F

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:219 Identity:47/219 - (21%)
Similarity:82/219 - (37%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSALCGGAVFG----------VAFLGMYV 65
            ||.|.:...:|.......|...:.|......|....|:.|..|||:.          |:|||...
  Fly    15 KYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCVG 79

  Fly    66 A------LKVSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRD---LFERKTHSD 121
            |      |.::| :.|..|:...::|..:..|:|     ||::.....:.||.   |:..:....
  Fly    80 AGKEVKCLLLTY-FIIVALVFVTMLIGGVLGYVF-----RERVQQTMRQEMRSTMALYGSRREIT 138

  Fly   122 DKMQPVHSLFGCCGIEGPQDYLQEEHGALPSSCCYAF------DCS---KPAHVYEEGCSTKAVA 177
            ...........|||::...|:  ..:|.:|.|||...      :|:   ...::|.:||......
  Fly   139 QAWDLTQERLQCCGVDTWHDW--NRYGPVPESCCQELFGGQRKECTIFPTITNLYNQGCLYVTTN 201

  Fly   178 TLRMQAELNYYSCMAIIALEFLGL 201
            .:|..|.:...:.:|:..|...|:
  Fly   202 FIRDHAAVIGGTSIAVAILMIFGM 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 47/219 (21%)
tetraspanin_LEL 97..183 CDD:239401 19/97 (20%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 47/219 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.