DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and tspan12

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_957446.1 Gene:tspan12 / 394127 ZFINID:ZDB-GENE-040426-1285 Length:301 Species:Danio rerio


Alignment Length:236 Identity:57/236 - (24%)
Similarity:93/236 - (39%) Gaps:51/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YGLLVTCILIVTC-------NVFFFSCGVTTWGSAVSVYGSYGS----ALCGGAVFGVAFLGMYV 65
            :.|:..|:|.|:.       ||...:.......:||..|.....    |:|...:. ||.:|...
Zfish    21 FWLMALCVLGVSAYLRDQLNNVLTLTADTRLEEAAVRTYSPVVHPVVIAVCCFLII-VAMVGYCG 84

  Fly    66 ALKVS------YKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDL----FERKTHS 120
            .||.:      |..|:..:.|   |..|.|.:.:....::...|...:.||...    ::..||:
Zfish    85 TLKCNLLLLSWYFGSLMVIFC---VELASGVWTYDEPMVQRSDMISLKSRMPHFGLQRYQWLTHA 146

  Fly   121 DDKMQPVHSLFGCCGIEGPQDYLQ-EEHGALPSSCC---YAFDCSKPAH------VYEEGCSTKA 175
            .:.:|   :...|||:....|:|: .|....|.|||   |. .|::.||      :|:|||..|.
Zfish   147 WNALQ---TELKCCGVIYFTDWLEMTEMEWPPDSCCSNQYP-GCARQAHYNDLSDLYQEGCGPKI 207

  Fly   176 VATLRMQAELNYYSCMAIIALEFLGLFTAYHLGKARKYAKT 216
            .:.:|...:|.        .|.|||:    .:|.|:..|.|
Zfish   208 YSFIRGTKQLQ--------VLRFLGV----SIGVAQILAMT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 54/229 (24%)
tetraspanin_LEL 97..183 CDD:239401 26/99 (26%)
tspan12NP_957446.1 Tetraspannin 9..245 CDD:278750 57/236 (24%)
TM4SF12_like_LEL 113..215 CDD:239410 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.