DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp66E

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:283 Identity:57/283 - (20%)
Similarity:90/283 - (31%) Gaps:111/283 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VTCILIVTC--NVFFFSCGVTTWG----SAVSVYG-------------------------SYGSA 49
            |.|...:.|  |..||..|...:|    .||..:.                         :|...
  Fly     7 VWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVLL 71

  Fly    50 LCGGAVFGVAFLGMYVALKVS------YKYSIYYLICSGLVIAALGSYL-------------FTF 95
            :.|..:|.::|||...|::.|      |...:..|:.:.:|...||::.             .|.
  Fly    72 VIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTI 136

  Fly    96 TA------------MREQLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGIEGPQDY------ 142
            |:            |..||||.                         ||||||....|:      
  Fly   137 TSYSLGENVDATSLMWNQLMGN-------------------------FGCCGINDYHDFDASPAW 176

  Fly   143 -LQEEHGALPSSCCYAFDCSK-----------PA---HVYEEGCSTKAVATLRMQAELNYYSCMA 192
             ..:.:..:|.:||...|.:|           |:   ..|::||.......|..|.|| ....:|
  Fly   177 VNGKGNRTIPDACCILKDVAKLVPRDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQREL-VIVAIA 240

  Fly   193 IIALEFLGLFTAYHLGKARKYAK 215
            :..:..:.:..|:.|.||  :||
  Fly   241 VGIVHLVLIILAFALCKA--FAK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 54/277 (19%)
tetraspanin_LEL 97..183 CDD:239401 22/118 (19%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 52/274 (19%)
uroplakin_I_like_LEL 116..231 CDD:239409 26/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.