DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and TM4SF

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:282 Identity:72/282 - (25%)
Similarity:101/282 - (35%) Gaps:98/282 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YGLLVTCILIVTCNVFFFSCGVT-TWGSAVSVYGSYGSA-----------LCGGAVFGV------ 58
            |..:|...|.....:|.   |.: .||.  |||  ||..           ||.|.|..:      
  Fly    15 YSYVVLLALTGAAQIFL---GTSLLWGH--SVY--YGIVQNKLWAPAAILLCLGPVTFILCWMGC 72

  Fly    59 --------AFLGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFE-------E 108
                    ..|||:.||.|:. ..:.::||...:            ||||.|....|       .
  Fly    73 QATNQRKRCLLGMFAALLVAC-ICVQFIICGWSL------------AMRENLPTSVEIFIDDSFV 124

  Fly   109 RMRDLFER----KTHSDDKMQPVHSLFGCCGIEGPQDYLQEEHGALPSSCCYAFDCSKPAHVYEE 169
            ...|.|.|    ..|..::||   |...|||::||.||   ...:||.||     ||:|.|.||.
  Fly   125 EFLDKFSRTKVDNLHLWNRMQ---SQLQCCGVDGPLDY---RRLSLPWSC-----CSRPEHAYES 178

  Fly   170 GCSTK------AVAT--LRMQAELNYYSCMAIIALEFLGLFTAYHL------------------G 208
            .|.|.      ||.:  :|.:..:..:....|...:.||:|.|.||                  .
  Fly   179 ACDTHYKRGCLAVVSEQIRNRLLITAFGAAIIAIFQSLGIFCAVHLTILFGKNDNTHPMNMNRKK 243

  Fly   209 KARKYAKTKIKDEE----TPIN 226
            |.:::....|:|:.    :|||
  Fly   244 KQQQFLPLTIQDKRHDMPSPIN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 67/261 (26%)
tetraspanin_LEL 97..183 CDD:239401 35/104 (34%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 64/239 (27%)
uroplakin_I_like_LEL 111..197 CDD:239409 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.