DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp42Er

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:131 Identity:34/131 - (25%)
Similarity:62/131 - (47%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GGAVFGVAFLGMYVALK----VSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEE---- 108
            |..||.::|.|.:.|:|    |::.|:...|:.  |:::.:..::|..         .|||    
  Fly    52 GSIVFLLSFFGCFGAIKESICVTWAYATSMLVM--LIVSIVMLFVFRM---------HFEEDSIT 105

  Fly   109 RMRDLFERKTHSDDKMQPVHSLFGCCGIEGPQDYLQEEHGALPSSCCYAFDCSKPAHVYEEGCST 173
            :::..|.::|::.|.|....:.:.||||...:|| .:.:..:||||....|..     |.:||..
  Fly   106 KLKQAFAKQTNTFDAMAEYQTQYQCCGIYKLKDY-GDAYITVPSSCYDQNDTP-----YRDGCLA 164

  Fly   174 K 174
            |
  Fly   165 K 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 34/131 (26%)
tetraspanin_LEL 97..183 CDD:239401 22/82 (27%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 34/131 (26%)
tetraspanin_LEL 93..174 CDD:239401 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.