DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:196 Identity:44/196 - (22%)
Similarity:83/196 - (42%) Gaps:22/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CIL----IVTCN--VFFFSCGVTTWGSAVSVYGSYGSALCGGAVFGVAFLGMYVALKVSYKYSIY 76
            |:|    |..|:  :..||..|     |:.|....|..| ||.:|.....|...||:.|.:.:..
  Fly    20 CVLAALTIAACSYALIAFSHSV-----AIRVPSILGIVL-GGLLFFSTIFGCIAALRESIRMTWI 78

  Fly    77 YLICSGLVIAALGSYLFTFTA--MREQLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGIEGP 139
            |   :.:::|.:.|.:....|  :..:|:.  .|.:.|.::.:.:..|:|......:.|||..||
  Fly    79 Y---AAILLALVFSQITVILAQPINYELLA--NETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGP 138

  Fly   140 QDYLQEEHG-ALPSSCCYAFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCMAIIALEFLGLFT 203
            .:|  .:.| .:|.||.:..:.:....:|..||:.:..|...........:..:::.:|.|.:..
  Fly   139 ANY--PDSGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVII 201

  Fly   204 A 204
            |
  Fly   202 A 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 44/196 (22%)
tetraspanin_LEL 97..183 CDD:239401 20/88 (23%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 44/196 (22%)
tetraspanin_LEL 95..173 CDD:239401 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.