DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:171 Identity:44/171 - (25%)
Similarity:73/171 - (42%) Gaps:26/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CGGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMRE-QLMGRFEERMRDLF 114
            |.||:||            |.|..:..||   |::|.:.|:::..:...| :.:...|..:.||:
  Fly    65 CLGAIFG------------SIKVMVVNLI---LLLALIASHIWKVSHYNETKQLDATEVYVMDLW 114

  Fly   115 ERKTHSDDKMQPVHSLFGCCGIEGPQDYLQEEHGALPSSCCYAFDCSKPAHVYEEGCSTKAV--A 177
            .::......||.:...:.|||.:|..|| ...:..:|.||.:..|.....:.|.|||.. ||  |
  Fly   115 MKELVHHGAMQDLQQEYECCGDKGFSDY-TSLNMKVPRSCFHTKDGIHALYPYGEGCMA-AVKRA 177

  Fly   178 TLRMQAELNYYSCMAIIALEFLGLFTAYHL-----GKARKY 213
            .|::.....:..| .:|..|.:|:.....|     .|.|:|
  Fly   178 YLQIYRYEKWVHC-GLIGYEVVGIILGITLCCQLTNKTRRY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 42/167 (25%)
tetraspanin_LEL 97..183 CDD:239401 24/88 (27%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 41/162 (25%)
tetraspanin_LEL 110..178 CDD:239401 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.