DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and lbm

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:211 Identity:52/211 - (24%)
Similarity:84/211 - (39%) Gaps:57/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGVTTWGSAVSVYGSYGSALCGGAVFGVAFLGMYVALKVSYKYSI-YYLICSGLVIAALGSYLFT 94
            |..|:...|..|..:....|..||:..:|    |.|...:.::.| .|:.||.:::.||   |..
  Fly     3 CATTSVKIASIVLNAVLGFLAAGAIGWIA----YNADTETEEFVIAAYIACSLILVFAL---LGI 60

  Fly    95 FTAMREQL------------------------MGRFEERM-RDLFE--RKTHSDDKMQPVHSLFG 132
            |.|:||.:                        :..|:.:. ||:.|  .:.::.|.:|..|.   
  Fly    61 FAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDVKSGRDMVEVAWQANNMDSLQQKHE--- 122

  Fly   133 CCGIEGPQDYLQEEHGAL--PSSCCYAFDCSKPAHVYEEGCSTKA-------------VATLRMQ 182
            |||....|||:   |.:|  |.| |||.....|.|:|.:||..|.             |:.:.:.
  Fly   123 CCGQSSAQDYI---HLSLLIPPS-CYADLQQTPDHLYLDGCIEKVQSFYESDKLRFIIVSWVLVA 183

  Fly   183 AELNYYSCMAIIALEF 198
            .||..::....:|:.|
  Fly   184 FELICFALAVFLAISF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 52/211 (25%)
tetraspanin_LEL 97..183 CDD:239401 30/127 (24%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 49/203 (24%)
tetraspanin_LEL <109..169 CDD:239401 22/66 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.