DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:205 Identity:44/205 - (21%)
Similarity:83/205 - (40%) Gaps:32/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSALCGGAVFGVAFLGMYVALKVSYKYSIYYLIC 80
            |.|:|:.|..|            ..|::||            ||.......|.:.|...:.:|:.
  Fly    55 VLCVLLGTVIV------------VASIFGS------------VAVAKDSRVLLICYAVLLVFLLI 95

  Fly    81 SGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGIEGPQDYLQE 145
            ..:|:.::     ::.|.|:.|.....:.:.||::.:...:..:........|||....:|||..
  Fly    96 VQIVLVSI-----SYAASRDFLPDSLRQGLDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHL 155

  Fly   146 EHGALPSSCCYAFDCSKPAHVYEEGCSTKAVATLRMQAELNYYS-CMAIIALEFLGLFTAYHLGK 209
            |. ..|.|||...||:|..:::..||..|....:..:. .|::| ...::..||.|..|..:|..
  Fly   156 EK-MPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGAKT-ANFHSLSWFLVIFEFAGSVTTCYLVD 218

  Fly   210 ARKYAKTKIK 219
            :.:..:.:|:
  Fly   219 SIRNHRDRIR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 43/195 (22%)
tetraspanin_LEL 97..183 CDD:239401 22/85 (26%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 43/195 (22%)
tetraspanin_LEL 109..192 CDD:239401 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.