DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp39D

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:236 Identity:55/236 - (23%)
Similarity:91/236 - (38%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VTCILIVT--CNVFFFSCGVTTW--GSAVSV-YGSYGS-------------ALCGGAVFGVAFLG 62
            :||:..:|  ||:.|...|:..:  |..|.: |..|.:             .:.|.||..:.|||
  Fly     6 LTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLG 70

  Fly    63 MYVALKVSYKYSIYYLICSGLVIAALGSYLFTF------------TAMREQLMGRFEERMRDLFE 115
            ...|||.|        .|..|..|.|...:|.|            |.:.:.:..:|...|:...|
  Fly    71 CCGALKES--------SCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKE 127

  Fly   116 RKTHSDDKMQPVHSLFGCCGIEGPQDY-LQEEHGALPSSCCYAFDCSKP-----AHVYEEGCSTK 174
            |..:. |....:.:...||||.||.|: ....:..||::||...:.|:.     .|..:.||..|
  Fly   128 RADYR-DAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNTHATQHGCLQK 191

  Fly   175 AVATLRMQAELNYYSCMAIIALEFLGLFTAYHLGKA--RKY 213
            .:..|..:..:.....:.:..::.|.:..|..|.::  |.|
  Fly   192 LLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRSY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 53/232 (23%)
tetraspanin_LEL 97..183 CDD:239401 22/91 (24%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 52/227 (23%)
tetraspanin_LEL 104..200 CDD:239401 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.