DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp33B

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:105 Identity:24/105 - (22%)
Similarity:36/105 - (34%) Gaps:43/105 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CCGIEGPQDYLQEEHGALPSSCCYA-----FDCSK--------------------------PA-- 164
            |||:.|.:|::..|......:.|.:     |.|.|                          ||  
  Fly   152 CCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCDSCFNNFLPSEGQSIGGNSRQPFPALT 216

  Fly   165 --HVYEEGCSTKAVATLRMQAELN-YYSCMA--IIALEFL 199
              .:...||....|:     |..| :|..||  ::||:||
  Fly   217 VDSINANGCLPAFVS-----AVWNCFYILMALWVLALKFL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 24/105 (23%)
tetraspanin_LEL 97..183 CDD:239401 15/84 (18%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 24/105 (23%)
CD151_like_LEL 112..237 CDD:239408 17/89 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.