DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:257 Identity:56/257 - (21%)
Similarity:89/257 - (34%) Gaps:84/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYGL-------LVTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGS-----ALCGGAVFGVAFLGM 63
            ||.|       |:|.|:::....   ..|....|..:.:.|.:.|     .:.|..:..::|.|.
  Fly    12 KYTLFGFNLIFLITGIILIAVGA---GVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISFFGC 73

  Fly    64 YVALKVSY----KYSIYYLICSGLVIAA-LGSYLFTFTAMREQLMGRFEERMRDLFERK-THS-- 120
            :.|||.:|    .:|:...|...|.:|| :..|:....|             .||.:.. |:|  
  Fly    74 WGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDA-------------SDLIKTSLTYSLN 125

  Fly   121 --------------DDKMQPVHSLFGCCGIEGPQDYLQE-EHGALPSSCCY-------AFDC--- 160
                          ||    :...|.|||:....|::.. .:|.||.|||.       .|.|   
  Fly   126 EYNSINPNATTKLWDD----IQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNA 186

  Fly   161 -SKPAHVYEEGCSTKAVATLRMQAELNYYSCMA---------IIALEFLGLFTAYHLGKARK 212
             |..|..::.||         :.....|.|..|         |..|:|.|:..|.::.:..|
  Fly   187 QSSVADRHKVGC---------LDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 55/254 (22%)
tetraspanin_LEL 97..183 CDD:239401 24/114 (21%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 55/254 (22%)
tetraspanin_LEL 106..210 CDD:239401 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.