DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and cd63

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:233 Identity:48/233 - (20%)
Similarity:93/233 - (39%) Gaps:52/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CI--LIVTCNVFFFSCG-----------VTTWGSAVSVYGSYGSAL----CGGAVFGVAFLGMYV 65
            |:  |:...|..|:.||           |:...:|: :.|:.||.:    .|..:|.::|.|...
Zfish     9 CVKYLLFFFNFIFWLCGLALIVLGILVHVSLHNTAI-LQGASGSPMVLIVVGVIIFFISFFGCCG 72

  Fly    66 ALKVSYKYSIYYLICSGLVI-----AALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDK-- 123
            |.|.:....:.:.|...|::     |.:..|:|         .|:..|.:...|.......:|  
Zfish    73 AWKENQCMVVTFAIILSLIVITEIGAGIAGYIF---------RGKVNELLDQSFNTMIAGYNKTE 128

  Fly   124 -----MQPVHSLFGCCGIEGPQDYL--QEEHGALPSSCC--YAFDC-----SKPAHVYEEGCSTK 174
                 :..:.....|||.....|::  ..:|.::|.|||  ...:|     :||..:|.|||  :
Zfish   129 EYRTTLDSIQKQLKCCGGNSSSDWVNFSADHISVPDSCCKNVTKNCGIGAMTKPTVIYLEGC--Q 191

  Fly   175 AVATLRMQAELNYYSCMAIIA--LEFLGLFTAYHLGKA 210
            .:...|::..:.:.:..|::.  ::..|:..|..|.:|
Zfish   192 PILETRIKENILWIAVGALVIGFVQITGIVLACILSRA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 48/233 (21%)
tetraspanin_LEL 97..183 CDD:239401 21/101 (21%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 48/233 (21%)
CD63_LEL 103..202 CDD:239419 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.