DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp3A

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:201 Identity:45/201 - (22%)
Similarity:74/201 - (36%) Gaps:56/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LCGGAVFGVAFLGMYVALKVSYKYSIYYLIC----------SGLVIAALGSYLFTFTAMREQLMG 104
            |.|..:|.|:|.|...||:.:.....:|.:|          ..:|......|:.||  :.:|...
  Fly    98 LAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTF--LEKQFTH 160

  Fly   105 RFEERMRDLFERKTHSDDKMQPVHSLFGCCGI--EGPQDYLQEEH----------GALPSSCCY- 156
            :.....||..:.:...|...|.    |.|||:  .|.||:.:.|:          ..:|.|||. 
  Fly   161 KIIHSYRDDPDLQNFIDFAQQE----FKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCIN 221

  Fly   157 AFDCSK--------------PAH-----VYEEGCSTKAVATLRMQAELNYY----SCMAIIALEF 198
            |.|.|.              |..     ::..||    :..:|:.||.|.|    :.:.|..::.
  Fly   222 ATDISSGLVNIMCGYGVQNAPVPEATKLIWTSGC----IEIVRVWAEHNLYVIAGNALGIALIQL 282

  Fly   199 LGLFTA 204
            |.::.|
  Fly   283 LVIYLA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 45/201 (22%)
tetraspanin_LEL 97..183 CDD:239401 24/117 (21%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 45/201 (22%)
penumbra_like_LEL 144..267 CDD:239411 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.