DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Cd63

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:232 Identity:60/232 - (25%)
Similarity:96/232 - (41%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYGLLVTCILIVTCNVFFFSCGV-------------TTWGSAVSVYGSYGSALCGGAVFGVAFLG 62
            |:.|.|..:....|.|...:.||             ||.||.:.|.    ....|..:|.|||:|
  Rat    35 KFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVV----IIAVGAFLFLVAFVG 95

  Fly    63 MYVALKVSYKYSIYYLICSGLVI-----AALGSYLFTFTAMREQLMGR----FEERMRD-LFERK 117
            ...|.|.:|...|.:.|...|::     .|:..|:|     |:|:...    |:::|:: |.:.|
  Rat    96 CCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVF-----RDQVKSEFSKSFQKQMQNYLTDNK 155

  Fly   118 THSD-DKMQPVHSLFGCCGIEGPQDYLQEEHGA---LPSSCC--YAFDCS---KPAHVYEEGCST 173
            |.:. ||:|..:.   |||.....|:.:....|   :|.|||  ....|.   |.:.::.:||..
  Rat   156 TATILDKLQKENK---CCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVE 217

  Fly   174 KAVATLRMQAELNYYSCMAIIALEFLGLFTAYHLGKA 210
            ...|.||....|...:.:.|..:|.||:..:..|.|:
  Rat   218 TIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 60/232 (26%)
tetraspanin_LEL 97..183 CDD:239401 26/99 (26%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 60/232 (26%)
ATP-synt_A <72..131 CDD:294288 18/62 (29%)
CD63_LEL 129..227 CDD:239419 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.