DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tspan12

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_766595.1 Gene:Tspan12 / 269831 MGIID:1889818 Length:305 Species:Mus musculus


Alignment Length:223 Identity:47/223 - (21%)
Similarity:71/223 - (31%) Gaps:102/223 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKSFPITPWKYGLLVTCILIVTCNVFFFSCGVTT----------WGSAVSVYG---SYGSALCG 52
            ::::..:..|.:|.|    |::.|  ...:|||.|          |...|::..   :||     
Mouse    86 VKRNLLLLAWYFGTL----LVIFC--VELACGVWTYEQEVMVPVQWSDMVTLKARMTNYG----- 139

  Fly    53 GAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERK 117
                    |..|..|..::.|                                        |:|:
Mouse   140 --------LPRYRWLTHAWNY----------------------------------------FQRE 156

  Fly   118 THSDDKMQPVHSLFGCCGIEGPQDYLQ-EEHGALPSSCCYAF--DCSKPAH------VYEEGCST 173
                         |.|||:....|:|: .|....|.|||...  .|||.||      :|:|||..
Mouse   157 -------------FKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQEGCGK 208

  Fly   174 KAVATLRMQAELNYYSCMAIIALEFLGL 201
            |..:.||...:|.        .|.|||:
Mouse   209 KMYSFLRGTKQLQ--------VLRFLGI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 46/213 (22%)
tetraspanin_LEL 97..183 CDD:239401 25/94 (27%)
Tspan12NP_766595.1 Tetraspannin 10..244 CDD:366035 47/223 (21%)
TM4SF12_like_LEL 116..218 CDD:239410 33/167 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.