DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Cd9

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_444177.1 Gene:Cd9 / 24936 RGDID:2318 Length:226 Species:Rattus norvegicus


Alignment Length:106 Identity:21/106 - (19%)
Similarity:47/106 - (44%) Gaps:19/106 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GSAVSVYGSYGSALCGGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMREQ 101
            |:.:.:.|..|  .||........||::..         :.|:...:.|||.   ::.:| .:::
  Rat    65 GALMMLVGFLG--CCGAVQESQCMLGLFFG---------FLLVIFAIEIAAA---VWGYT-HKDE 114

  Fly   102 LMGRFEERMRDLFERKTHSD----DKMQPVHSLFGCCGIEG 138
            ::...:|..:|.:::..:.|    :.::.:|....||||.|
  Rat   115 VIKELQEFYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 21/106 (20%)
tetraspanin_LEL 97..183 CDD:239401 9/46 (20%)
Cd9NP_444177.1 Tetraspannin 10..215 CDD:395265 21/106 (20%)
CD9_LEL 109..191 CDD:239405 10/48 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.